OCR Text |
Show li. IL1 - - ' r'"" I I -- - - . t' '' - , la '''N'' , , - ' - ' ': - - ' ' - '' - ' ' ' '' '' -- '' : .' ' ' ' -; ' '' ' ' ' ' - . i t , .,. Retiring ,..,' ''', I 1, Champion s'' I 1 t 't i !' P 411! , ; - ,..;...,,:'.7-',- . Pugilist Says Her Health in Caring fnr Him 7, i , , - i!' , . ; She! i,-- '1 ,, , 1 ',, --, '1-1,-- ".erelel11,1,m1,11!ET .' 71 --or ,. ) - momn.d, ::i:T: , .', - -- ' 1; No t - ;;', 7 ', .,! ' ' ' -- ' - - , ... .. , , . , , , fil:Agerell- A -,. - ,. .. l," Bf tt --eet.ed by gtoto Utak two-thir- ds ber, elected to each of Osed .. .., ill , ,. .. ,....: . , - , , - .. , . man-D-' at Joint W06111004 Proposing tkorovotst resent election in the -ment to diectoa ft Article lit, of by law. etelectors the Section A If adopted by stituttow of the State of Utah. Relating the State. this amendment shall take et-to the Compensation of the blembr - . ':;'1.:Ciiitglittillotit:Atiletidritti . ,, ,:, ,. , I. , ,,, i - 4 ' , - ' ' 190 13 ', ' ,'',i,', -; - ,,,,-,,, , i ' - , - ' ....Saluting. , ., '''' eisó iCids.. Acidemy-:ilid,Hii,c,S,k'c- HIM :.. I i .) t ' ,... - DEVOTED; TO .,:.;. 1,1,:,,.:......,,,,,,-.....,- :', t -' ,,,,,5 it 1 1 ,.: , , .,' I, I ''. Military . I! , , ', L -- NEwis FilmAy. SEPTE3IBEIL : 7.. ., pentane' property shall be exempt rune taxatioa; Pr bolded further. tyllto trts,, taxes of the indigent Poor mined or abated at such tints and is er " ', cd - 8.ctio.,.1. The of Male is hereby ordered toSecretary title prophet- -'s Con to be published give In at least ese. , 4,40,,,-,-thereat i concurring , . newspaper in every county in the state 1 ' ',111 diction t. 'not It to sol'oroord to snood '1 ' f," ' where .. a is newseaper printed and pub Section ,, Article Vt. or the Coostitutiolias , 1,,,,'' lighted, for two months ., :r.,. ,k... ;:; 4..,, read will HE HAD A,r), the same Preceding s of 1:1h, se that the SUICIDAL MANIA ...............I ,; , I next general election. ' , fon .'..7"...N4 :1-,ivCI'117 ts ,..... 4 ..,,. Mentos 3. This proposition shall be ,. SRO , Mon tile st , otlierithe by provided submitted to '' the electors 1,.., of this state ' I ; members of the Legislature ban receive g, ..,..,' ,,'-ilk' ' st the next general election for their . .. ,.$ ' ';,'' , eight donor. (PA) Per del end "It !: t 'Tlirl 'A.V.: approval or disapproval. All wend .., !', , Coterie WI cents for the II t., - Atter right Stith Jeffries Was Victim per '. , seed .. Wien, at such election shall , ,. hen eerily traveted lining to and or written thereon the worm, printed moat I ' ,r, i' : the 1 ea from smoothie the of Place ', in 1 if I 'oV - ,t,,, ''' For the amendment to Beetles 8, Ar;' i .r : Li usual rouse. and shag socedire se other :.... Of 'Nervous Plotration , ticle 13 at the Constitution relating i .' V r ' te t ,: '':', ' or ' .,!' I Still Feels Effect. perquistte. the classification of property for purJ I ,, i il: The Secretary el State le Pha; I '..; '.. .., ! ' :. ' , I ,. taxation." poses of 'Tess". "No." ; i . ' totelemtd 7 am ' entemit I ti. directed to tLl ,', 1 Il' '; shall otherwise be prepared and sub, '' ' , . amendment to the electors of the $tet at . . , milted to the lector ea may other. ,4 '' ' i d , the manner the nest emend ieloction , , -1 wise be provided by laws and said Chicago. ,, Pitt& Mrs. Sept. J It I ... 1 Duryea law. 'swotted ) ( by ballot shall be received. counted ea ' '1 M ' olohnson, wife of Jack Johnson. cham- ,, :' Seetion glee It adopted by the Meters canvassed- and return thereon I ' ef. talle .... shall 'I, amendment the this State. In the pme manner and in all be made pion heavyweight ptigitist. died a CA' each! 1 4 .", ', i :, respects fect January Ia 1t3. , y as is Or be I' ;'," may provided by law ta tide oiler wrecking her health in coring ear ' 1 the case of election ' I .! of state officer 11 , p.I ,State of Vteb. Office of the Seereterrl II i tor her husband. who was a victim of , 314 ti Bectlett If adopted by the electors I '''' t, ' ,, l ,. herein: ' of 1 ., Stafwes !,,i otthe ovate, this amendment shell-tak- ,, . " ' . , ittervotts prostration and suicidal mania one Section I.-- That Is is eroCcIrc , ,.. I. Chart.. I. Thiaol, Secret"-- , el !tat '' , effect January Ist. 1613-i4 ': :' a. , , , ; . of the State of Utah, de hereby certify amend Section a of- Article II. of the tor a year on account of injuries and : ' cc 4.,, ,sAna . .: Utah, Constitution-otree theStattrot f foreseing--11. i ' ,r. Stale , of 'Utah. 0Mce of the Secretary , p l .... :exertion during bilk tight with Jeffries. "gliSa correct copy inmenrigtkos proposing an that the same will read as follows: ,f A Ali property in the' Statat,,--n- ot ; ,, amendment to Section it, Artivie VI of :: This was tnetestimony of Johnson at . Charles tel lit I, ,.. United S..Tingey,the of of et Seemtary , rtott, laws the Cniatitation of the State easlinet under the e.r. ;;thWc !t Constitution. or 'Rate of the State of Utah, de ' WI pa inquest today over the body of or ittatea. this ; ,' , to the Centorneattoa of the Uwe under roottirs " that the certify , fent. , ber of the the laws of the State of Utah. 'that! be hereby , i' Ow Sirs. Johnson, eho shot hereelf last , .phel. b IMP tierreite ' Isnot list .precilided blitiwr'.:Thfr'Ircrd' ;, Ill'teltttoringt) i;, : . . Itithil in her apartment over theirtam- - ' 7 rect '' enpy a reetolutkin Is cmel article. till Sot"' -ProPootts in se ' tho used great filmed and hand my et an ,proliertir amendment to . . Section 3. Article pion saloon. , ,11 , th BUM or Utah. at pall iAks MY. Icerebe declared to include money. I ' i. if , It. of l . of the Constitution-"I' ';',00 ,III. and Johnson the said , franchises. the , State nature and extent of credits. bonds. stocks. . this Irrid (day of August. ISM of Utah. relating to taxatither.--- -'' ' i ' his sufferings 'after the champronshin gig& INGET. all matters and things treat. Porsche" C. S. 101,10 li I In Testimony Whereof, I ownerhere. , 7. of Stets and mixed), capable of privateconsitrueal a had fight been secret Secretary Indy" between wife onto set my hand and affixedhave his '4 the be Great not in shall but this ... ,ii ;. siesta" and himself. ship: Ileal.of nee Ileatessf Utak- at Salt Lake ; to atftitoriss love tt "I am still Buffett:la from the effecte on as city. this Ilud day of August, lilt Resolution A flint Proposing I of any stocks ! 7 '1:1'4 of that Bile C. R. TINGEY. , 14. (Seel) to v or of Artie to 4, fight. to isome extent." he mid. Amendment such company , section of of the when 4 property ,,, seise 'i Johnson was in tears. the Conetitutiott of tho State Of Visit. eerporatios represented by such stock. Secretary of Stets He sal,i his of .' shall Itht ell ; Wife's efforts to keep him from cominit- Fixing the thsti of judebtOdnael tame& The Legialature ' t A Joint s has been , ef"Intfra. CHUM. Towne, and School Itestelle as rtse tioir suktde WM the result of her own . wbiyt blaowthfeorr otionu rarnean nos; sisdroovindts :oral; Ameedment Resolution of Section 4,Proposing trif Article 18 et ' ',,' ,.. 'broken health. 0 oriel ex- - the Constitution of the State of Vialt. of th. th it meolved be estimated ordinary logistature the i10 I . believe I Incurred brain fever or ',' Std" t each fiscal year. Relating to the Taxation of Mints Slot of Irish, of all the metro rto nsdefray, for of the State 4 .. SIM Be it Resolved and Enacted by the Some similar dertuntement from the ex. bent elerted te ogre of the two houses e Lositielature obeli also provide for :41' I voting On it debt. if any Legislature of thoiState of Utah, lee. in favor thereof: oirtions, and the best of the Jeffries & the payment of the elatesame , 09 ',''' All Thirds Secof the bit amend Mombere becomes le Elected Section It proposed to ling t' there be. before the tigtit I was not meelf for a 'sr, but ' of the Two NOUS tion 4. of Artie etski 8 the payment of ,Esch It of90thothatConstitution Concurring the oecret was closely kept betaeen me , due: and provide for debt . therein: sante' the Of as Vtab. Otate the of it may Section I. That is is .. and Mrs. Johnson. She saved me twice the interest on said oscher. will road as Pincers: te ' fall dun 1.'When I tried to chokes myeelf todeath oth nte Section 4. of Articleproposed 4. 'Whoa anthorisoll to create indebted-- , 13, of tin The Peeretary of State is 'amend Section ' i mark is She seised ma and- etrogiled with ems as provided in Section I. of this hereby ordered to give this proposition Constitution of the State of Utah, es the same will read as follows: 1, ,1 boconse indebt.ol 001"'" and prevented the act. She bad an Artirle. no county , In be publiahed in at least ono news- - that !'1"l.. , I ,; '1'4 4. , All minee end' mining claim lodebt-- ' UI Piste. the ha an in elliatille amount. including in time plue awful county Ito every taking care of me for Over both placer and rock in place. con. Moms. miseeding Iwo per contain. No-, disiltell I newspaper is printed and pub- a year. I am only telling thie now in or bearing gold, reilver. maul' rite. town. school district or otherindebted limbed. for two months proceeding the taming elehotti t juntice to my wife. It never has been lead, or other valuable precious roppkr, shall become, Month, neat rips! corporation, tertian, general b ', i wry toil Indere j purchase thereof from the Utilted to an amount, including milating indebt Section 1. This proposition shall be after --,' sin, , ' States. :. hail at be taxed at a value rot etions. exceeding four per ennuis ... The Jury returned a verdict that Mrs. submitted to tho electors of this State than therethe 1 their igreater for losable ohnson the the the value of election ION price Vetted pmeerty r" paid next di committed suicide while ternat the J 4 'states ' official therefor. unless the surface , tT, , in. tho value tobO ascertaini4 by the Atm ini approval or disapproval. All , ,. porarily insane. some or purground. have shall semessment thereof. of County election for Stall part such fere will pod ballots used at ouch Jack Johnson, in telling the circum, t 'A ' poses. previous to the incurring of ouch printed or written thereon the words. mine or claim. is oiled for Other them tance that led to his wife's death. , in4PbtP4IfloW01: ! Crlefli that to bworporsted 'Foe the amendment of Section 1. Ar- mining purposes and has a separate ' tt , . and 10101 aid: independent value, for such other ( cities the assessment shall be Mhos from ticle 1$. of the Conatitution relating '' ,t,' : purposes; in which came said surfers Om !BSI ameaement for city Parroseal 'During the last two years slut often general taxation of property. ' I , i Irdrtited- Ito the "No." ,) , : me she wail tired of living. Mho otherwise be ground or any part thereof. so used , told shall ofthe and provided,- - that-n- o part ' .'i ' t e heel A110ir04 in this motion 'hall be tm prepared and submitted to the elector for other thao inining purpoars. shall $ tried to kill herself on two occasionsgest. I, . current for other, than Meetly county- as mist be provided by law. and seid be- lased- at its value, for such other 07e. ; Once eh attempted to jump out of le Willisi .,,..,.,,,,; town. or echriM distrtet purposes; ballot shall be received. counted and purpoeee. as provided by law; and all rify. , in a London hotel and previous window ''' ''''.4:'..',,:the canvassed. and returns thereon be made the machinery used in mining, sod :Ili tillet" fr ' provided further, that any elle of . t to that she tried to take her life by and surface improvements 'Iltic t" i first clam and any city of the emend in the earns manner in all respects as property , ' : 1c --- i ', or upon elm tn the at over from to law inhabitant. eltioN mittleaping mines appurtenant train out and be by tyftvtilpt ItcPtIVI polo It, : weet, is or may provided i (( Ink claims, which have a value top- - rotRocee ' ' authorised os provided to Sectkin 3. of case of election of state officers. "I did all could to make her homily ', ... ..;;; ,:".g.,i ,,', ,,,"'' , ',,,' , ; . ..",''',. 4. If adopted by the electors erste-antedependent of ituch mien thle Arttrie. trey he allowed to lacer ',",...4t I i. Sortie and on money her spent t tem era, but lavishly. or '7,':',1c7.,,,Y.I''''7,":tC,'. ' mining rialtos. and the net BMW ,:' ,40 '',:v... ';;',' hinter indebtedness not entrooding four of the Suits this amendment shall take 4 t ., - '...,:' '''.. i:',, tr':' ' ''; most, of the time she Deemed despon. .,' a nit t ', : of of arid additional all such PTOCIOUN Ant& 1111. any proceeds ; ' rentam . city !.''.' ;7'' 'w" "' I , lat. per effect l';',''r''''''''It-P.C4rt ,',1:;,' ''.,; January ' ,,,t,''.4r:tr'..f, , '' dent. Her father died four years ego mines and mining clairns shall be tax.. In ItnIM 4',,t'' the Demist oleos haying leas time !Odra ' . . '4, , ',) ...1...,,.,;, .. t,f;i '., ..', '.,' ,' ad s,''J ', t I .'' - Ond since then she seemed more nerve as th.rd tho of it law. dltaad and All inhabitants lands ess. sny illy of Utah. Office of the Secretary taillinffprovided by Stets etatst--e; ; olio and despondent than before. coal. n or sten ne Pranill rises. or town. whoa nthertoed as storm of ' - "I a , , dooming, to allowed Ise , , ' 1 after incur krire I. Charles a. Timmy. Secretary of tho said. may purchase thereof free employed two maids to watch her teeth her ' ' CAPYriatt lilt. by American Press Association. United States and all property am . , , indebtednosie not exeeeding eight per after she attempted to end her life the State of the Stale of Utak. Raman I additional foe tho purpose of sup- do fore- - surface improvements upon or awlthe that one first conand was certify of them hereby time, r,;cetseht ' Colonel.C. PTowbeIey bu just succeeded Major Csnerst Thomas IL Barry as anpertntendent, of the rnittd soch eity or town with water. sr. going is a full. true and correct 'tenant to such lands which have s vai I ii . ping etantly with her.' Yesterday morning II It an se separate and independent eg oil Uncial lights. or eetwors, whoa tho moire ropy ' of resolution States Military seadomy at Wiwi rolut.tieneral Barry bating been appoloted commander of the department of the proposing 11111 eh meemod in especially good twilit. such water ouch or, lights. n Yoe and the laud, tiet litt"11 et Proreede Article amendment to Section all, oast enetwedine the late tettertil Grant. General Barry is at the left. Colonel Townaley at the eight. The other plc. mowerssupplying i i and I had no idea she would kill hers abaft be owned sad controlled of the Conetitution of the State of emelt land and the byprod ucts a slit lbw ono , valuable therein contained .4 deposits the montripallty. lure thowe cadets farewell tooluto to General Barry. by ilm nd ore boot ' Utah. relating to taxation. i i Z'' crude or raw condition, lbw' See. I., 10 Mecretary of Stele le here- - taxed in , "'rho. dories that there was domes. rem nre In testimony whereof, I have to emote this proposed anwohnont unto eel ,, and hinged the Great be taxed as provided by law. . heed evwe , ,,,,,,, my between ,e, balined ;, Section 1 The Secretary of Mate i se romuired by tho Cea Seal of the State of Utah. at Pall Lake learnt, it to be published nittilltru;f.habendcaummseY shit er 1 hereby ordered to give this propwatlUi ,," an, atitatiovi end to he leubmitted to the of August lett nervous breakdown and tha doctors form ono of the meat attractive feat- Rom of said Court In ('ity. this Ilail day to be published in at least one sews Lake City. 'n1 of al C. S. TINGE4, of Om State at the tont osmenaleleati..''' t ' (Seal) son Lake 'County, Utah. law. ures of him private gallery. manner paper In every wife and myself mode our wills several wanted to mend me to a sanitarium. provided by ime in the in the still t I Secretary or State. Of where a newspapercounty let me go and nursed la printed and nib Tho 'Gram!. Fragemarda." Moe etas Witness the Clerk of said.Court with flee. S. If approved by tit. Mertonshell months sat each agreeing to leave all "she would-n'Owing' the seal therm? rtised this Ilth day of the Stat5 thia proposed amondment Pelted for two months prece4tn ',A me day and nIght for months" an i ," ', , ono Providin to the MO who the A Resolution survived. ahottt g painted Joint by I pi property rragemard lentor by ' AR VAL take effect upost the first day of Januar7. Amessimeat to Section II. Article 11. next enteral eleetion. , Dpopito Johnion's protests t lona that prior of Louis XV of Frones for limo. September, trell ite th . "My wife was suffering from nervous S4411011 MARGARET ZANE WITCHER. This A.D. ltit, shell of Utah. State proposition of the 't was Constitution Mere tou realthe of of the brat nothing but Barry. ono of tit kingli favetritoot. (Pal I Atulatilin to the electors of prostration when I married her and had ists Ste Boards submitted ibeen under the cars of physicians ever betseen idembes or his lantilv and i Tha Picture. he odd chance,. never SY I. P. Palmar. Peauty Clerk. Ow doerotat, relating In State and County at the next general election this ' hensior for too ' atop of rtah. Offkat of Equalization. for- - Potitioner , his wife. tho pugilist's mottles teas not raAJir4 thole domination-beIWtwal roma-Med since. Riot approval All of pr dieepprovet ea Witt.as Be It enacted by the Legislature of ballots used ' hi leragonarera studio until 1702. ahem of ,. at palm such 'floret. Imit It Ileefotory election a , "After My light with Jeffriee I had a present at the inquest. shall Mottos i of all of Melo Utah. lati Stets ; i DISTRICT of tho putt of Ilan ttoroby rortify the IN THE Turan printed or written thereon the eon lii tho reign of torror, thoy wore res to of eloetott each the members Istmata. of the 0' -e .1 i in and for the County of Malt that tho rotaries" to a thelt fres and corr., "For the amendment of Section 4. At rounvel sooretoly to his native city. Court, houses concurring therein! , 3 1.;1 18. of the Conatitutioe, Lake and State of titan. In the matter met topy of a roantattott pTnnq an two SEEMINGLY HEALTHY, retail,. .... . Section I That it Is proposed le tide Graomo, A French art oxpert. ditio of the relate of Ellen Hanford. Dereased. antenettnaat .. ' 4. of Article 14. of to the texatios of mines. "Yee." to , Section i ) 11. of the 11, Artiele II Section 1, ' amend covored" the Wee la in pile1that of and filo Of and Mat took shall Notice.Nolles rtah. otherwille be prepared ar paintings hereby given 1. tho Cottotittttioli FOR se WEEKS of theta SLEEPS of 44 Hovf to Gain the Coroilitlitifte flab, thorn to Cannot'. a here they fetched 11111t to an order of the Third Judicial Nina the Mott of tottetotettnemo eq tvmn. t submitted to the electors as may b4 ', that the same will read as follows: . . ! Distrirt Court, In and for the County of Ilea. rift'. town.. and aelown dtatri..ta. S:h0000 at auttem. provided by law. and et , law. mhererine II. Until otherwtes provided by of Utah, made on home:tun holm I Malt Lake and $uit wborsof. , ballot shall be received., counted sr ,4i tonsil-tattoIn board trathootty of shall be a state Bout. Brooklitio. Maas,. ' :1 A ,otmgla but auto bey' to the Inth day of August. A D. 912. in the tot to, hood and 'Ottawa the moot tool there ,13,Apol increase seed, and returns thereon be soot of four residents of , conalating alb 10,41114 It to anoPrted by 'bovrtal parently sleeping natitrally,Mtas Aglow matter of the estate of Ellen Hanford, of th ,i, and in all rawer sto of C00 at Itott Litho City. the State who shall be appointed by lin the same In NOTiVE, , &weaved. the undersigned Elias A. Stunk thill nod doy of Anut. lint volt knows.physiebans. to Ito take as la or may be provided by law la 114 Mow . a student In tho medical um's, the overlain by and with the consent Of the said estate, will sell C. case administrator of tor, orroral "noosing ono or two of eleetion officers. ' ..,. state Notice Is the senate. whose terms of Moe gtvon that the oseesa:tort). solo for rash. on the hith day (Mot) 4. at , 'ablate after 'garb high school has boon unconariona for ment of thehereby Ilotiotar of Wale of by the elect adopted 7,,,, rowel. shall be for four years and until their of Section tag levied by lbw Bowl Of of private A.D. ME at II rielork Those Hui tablets has tho Me- - throe, works A lit of hysteria brought Commlesioners the State. this September, amendment shell tiO successors are anoeinted and Ooliftest of Salt Lake Utah, pm.. at the riffle of the Derberet Savi , ' 4 tinguighati ingsrit et Innongaing IA red on hor nooterions malady. tihe went tor ordinance paosed SeptemberCity. Anseediment to 'Potion provided. that two of said member effect January I. 1911 as ISL.. ings Sank. Salt Lake City. Salt lAk4 Mb,. Proposing II ) whit ' Alain blood to en4 n9PUCeled us I aidin t, It 4. t's sloop while Oohing i.e. upon the property abutting upon lots 4 to Connty. State Of Utah. the l01101tinil peo, 1. Attic la II of lb rtmatitution. Mati- shall be appointed every two years. State of 1 gelation and pmntoting ago' ina MIT float rotwort and won brought UnconUtah. Otlice of the Seer. ') Cities and lawns. and There shall oleo be in sects county of litcluintr blotit Z Eittli h ubtlielotion .one( property. ng to Conon, E I ,I the riomrotoin of Now CAN-ti- e the $tate a ("entity Board et Equalise- of aboorptimt . Medford of bonito thS Stateea to in scious her I4 1 for 3 of Creating Mork 4 lt; block ncitseive, note Providing Id; Wet , for ONO cwrtaln promiehory torhieb go to make Mono and solid rkg, I. Charles 11. Tingey. Secretary ,; A week ago. she WWI taken to a And lion. eonsitatine of the Board of block -- I. 2 to incluitive, block 24, dated May ISM A.D. HO. and payable roues They an obtatnable tit asolotli ,,, of Commileioners of said county. County the State of Utah. do keret' Jet theN 7he lotato of that Brookline hnopital whore abe la atilt aII in plat 31." 'Salt Lake City Surrey. eight years after date, and OPVISTVA by a Re it rerolvad by tho Togof !slum live11 metrolls all -thratelana I. the foregoing he a ft -of gorkagas Board icertify 1 1of State the of tha 'Pato the ' Equalisation for and duty ptak .11; of reel etifficient Round normal and grading, shit porpoise upon. is Her guttering and morteage pulse stooping. good bottles and of the several County Boards of Itrue and correct copy of a reaoluth ion keit anotbortgry hopo. curbing with tement, and paving wain as- estate situated in Malt Lake City. Malt bers holed to each of the tiro to bat healthy. Li':1 an sppears be amendment to Potties to shall proposing irsettlizatios and adjust the Post side of Firth Liget Strest Lake County. agate of !lab, said note concurring: , , phalt. 11111111110..1111111111111111.11.11111111171111 ?tilt ft to propmseg n 1...cd equalise the valuation of the real sad flowttee , betwoom nub South and Ninth South totereetst per cent per annUM Pontine rooms' property of the Nude and of I of Article It of OM CooMitetrPetti in Paying District No. r. la com- hearing One of tho MORI COMMan alimpnts Terms of hat of Ptak, so that tha the tievertl counties thereof, as may tho of ioo Fey further information aPe Pllias A. Pam. shall mind ass follows: that bard working poopin aro afflicted pleted. oo, provided' by law. Back board shall the Board That commlosioncrs Bank. Deseret of Cashier Savings 'Wing amitte with is lam. look Apply Chamber'Ms Pooeval matinee of rho Territory also perform such other duties as may unto sot my hand and Mint the One a a board of rotialisation and review, Malt Lake City. Etat'. the MoptSeal of the State of Utah, at Conference Visitors Weltif nob slating at Om throe of lain's Liniment twice a 'day and sill meet at tho office of the City provided by law. ELIAS A. IIMITIL aro bereby beSect. L The Secretary of State is City. this 82nd day of Autrosts 1111 at each t and County Build-lo- Adminiatrator of the Estate of Eleit ioto of thisas Potiatitutinft, mimosa the ports thoeousghly come to Our Rost Rooms: diolo. el)' C. it TINGICT, divisiona of this directed to submit this pro- - (Span meogniand on lionday. September lath. Slit and Ma n ford Derestaert. application. and you will get quick, ono, hereby Searetery of Wets posee amendmest to the electors of and the proem.'" and school 4fittrlett aid,continue in wession each day until FriThotnee, Attorney for relief- - Tor sato by tal dealers. GET ACQVAINTFD OFTE111. slate at the next general Cootie slitting In said reuniters as legal the between day. September 21ith. so roe- the In the manner provided by law. Mviaton thortof. n4 (hay shall For Oa days we alit do dented IITOCEMOLDER. MEETING. hours of 31A and 4.kt p.m. and will hear hi putimanea law I. It adopted by the teeters by changed Section until tinue fisION work at real At materials lotus a monrit ElErt and 'consider any obtertinna and make IN TIM TilitTRICT COURT. PRO. 'Phi togislattins may h., of the Mats. this IMPOilMeet article, this Toe-a- ro ban of nett 1.ake said cf which for correction in tat Ward small divIsion. any nut bat and., homby milted 'Mist lit very of town margln. P.m foriestios September ilth. take effect Jailor, 1st, 1111 I ma y Moth unequal or unto's!. f nail. In 'the matter' follral law prierbia mooting of tit stockholders County. S(t of ueoplo can avail thOmoptv- - of ehin &mottos. and locating the emmto now The IV Wow lAt the Treasum Mines Compar it4,p(r.. mid between Irdward Golden Lederman's., Trutt time. estate Linn. of Short tho Via retool which "hall state of 'Utak. 0Mcs et the during opportunity and save the root et a a a.m. and 4 p.m..,soild init will tiocetuted. NoticeThe petition of Rosal mots thareof, Evero tonally will too held et the 'Mos of NoaII Brett Secretary of hours and Idaho 1:toth from ow point& to northern talon territory of Stateea91. erg and Armstrong. at IIT Meet Nur, trip to .Solt Lake end the State at the office Ledermatin.- - the adminiatratrix of the ha formed from shall bo !LAM Mee, lintel be open to piihito iii.Irption City ticket Ifit,.e Minolta. I. Charles aoutity or rountiae Fair. Painless system Secretary of Tomo le streol. Salt Lake City. Vie docossed. other of the City' tifreorriz.r, ROM twl, City and eastato of FdwardlAdormann, I : of flI. filleting dams State of the etatoTingey theft. a of do oroperlion for Mgt on the 14th day of September. of It'utts. the Lake sale fol., of hereby l'tah. the for confirmation City. County Sanding. $all DR. !C. U. NII111Ni a COe AND of the empty or imanti,, that the foregoing in a full, at I 'clock order of the Hoorn of Comminsion- lowing described portionsl property. to, sad liabilities p.m. for ths sumo. DENTISTW. r ouch bwrihwy Ash ba thh.n. motif, which from 1012 officers for the compost! stork 12, electing dated 2,712 urea of the capital fro. wit. September 1111,2111t vow ha no Ash twenty that TUNNEL ti 2101 04. Maktlik MYSTERIOUS Salta Si the ensuing year. lied tor the S. f NtoilLK WARSCII. of the Western Foundry. & Stows Bo-- , provided:unleall isainvity of tho quail-fle- d action of any and all business for the, homed a Recorder. tito ktrit AmimmNI pair Works. IN BOSTON otortora voting In each loan at th. 'tosuAirunty dal DISCOVERED should Pat Ilia liCatt.naitio No. isi, erste sum of $11.000 end upon th following, itTahl migularly COMP bolero ths thit, disinembered to be Aunties ea: or Board. of aunt mooting moldy of tho Charles' second and Pinot Estimete. Ths purchaser, terms', therofor, vote mmersioly JOBE KINGDOM NV. Cromer, to execute and deliver to shah Published &Wernher 1.1til. telt Is:: ails" 1411,1Z, ,,, g , t Thit IllomrOtarl, of Piste is 41- LAWN MOWERS of paellas 1 submit Itostion. Se pt. niyaterious tun. I: s,.., Ala propoeed petitioner thirty promissory notea to in-- 1 ratted cent WrOCKBOLDERS' A $' bbertilened and net, Haim per each, bearing 'even of the Nista at Ow City. this 22a4 day of under the street in PRODATI: AND GUARDIANSITIP ltilt nal .tuot rout to tho otortnno four month. one ovary t payishie, West. hi Airtime ths IL C. po, Inane, Court square is thotiatit to have been teali UNION RAILROAD j from data of th confirmation of the nest several fa xancEs. tor laic writ--PANT. I model Prianiars attempting to egrape, sato until lite whole numbs)? shall' oidd If adopted Inv the alect.cd Boehm a of I of ho ilti.iitierg three to tell:i MEETINO. been froth tail said solos ANNUAL hove shah take the gusta. This ammottnent I I a Broadway. A Joint Rosolution Proposing an New York, N A TX Mil by pia,ma in ncrovr said 11132 fret eentitri ago hi the obi courtisouge. al caratot County Clerk or respective sign. q1 ' ere for forthor informallow. lAmendmont to Section 3. Artie I IS: of Tb sonnet meeting of the stockhei, , Foundry 'shares of floc In the Western tleenct;khett to inake way for ere RAMBO o. vertforatkoot Our of of Work PACIVIC Constitution Stela th Wove of rNtom Pepe it ,, vtak COMPANY will imp held at Ile Mica of tlio fildtrfaiary of acne 4 ritr heti nottex. to Taxation to remain until the obit of Ptak TI notating 1)INTItICT 1"01RT, l'flO nil of Paii 04t, f kit.1100 et. Wotioneti removing the iiint ittitto State as so la resolved and it snorted amount Se I t4. paid. full Division bate in and rot Nal( Lake Counths ?Immo. ficeretaro of mat. by It 1Mu1et(1tRIK6 finiothithin ,if the courthouse chortles of the f, 1,Y1111 in filed from ti return of sale some' tv. Mat,. Of l'fah. Deportment No. I. In li k dot bomb, Perth', Legislature of the Stab' of Utak two. , 4 I boarinst ea ay ibo rate of Ptah, fogitti thst entrance to lite tunnel looted to VilittrOf of the estate' of Miry ft tits, yowl, bite beew Is S Mi. Into and roe. thirds of all the members ). street levet.- The! thy th ditst of September. that th. foregoing rosolution proominst th. each of the two houses coacurring -- The 1)0,Noltiltod n Noletre 'us feet below tho Friday, ttnetignsiv eatts,att met led re. a toot and such other butanes as may lelanY eee' 7 the 1112 at o'clock ' A. IL. p.m.. throe therein: Pip' Ives hole of Martin N. Lindsay. praying for to Wooing, I of Arlie,. XI of worn& PM ariTit Omit linos. In the Court artwodnwrit Portion IL That It M Droposed to before the meeting. onittilesion to probate of a cortnin reumy smut that part of the citiirthitowt is Conatitottem uf tho pinto af tha of ammo& steed Si, Rooms otArthilo we hare a meek! machine tor re- from Action IL of the Poe the purpose of the meeting, co,art. document, purporung $o ho tho tan emontfm rine" and towns., soW1 which- in .furnie years itad heen .in Walt Lake Odin. nivir books for the transfer of stock inet-of th State ab.. of tonstitution Nil Utak 11. bind so new alma, roue-ho01 domakes WA and Testament of t tor lbs mating Buchanan, reacting Barr o( few 1pfl. There nothing tl 1,i! t pairing forted and Comment win be ("need the same will road as follows: Witness the t Ierk of sold Court with vomitlag that Millaetl. and for the granting of lAtte,ra walled 7:15 been ever , !tad notpwomra. tunnel A.1 the that a "Minted this Ith day The , shall provide by e'elock p.m. an moNaokir,, $Err&tin.' restsmentsry to Martin N Lindsay, Imo the seal there..c In toottimony whovper. y bait h.,,,,woo law for a Legislature rt)0114 saWatatteh 41101. et A telk and ion be 1012 14.. ad oquitablo somas. lip. which atrenathened the belie( that been let for Peptemh-- r lust of Om on the kith seal $od 'filled t4 , fTil Friday, groat hand tot my hring 8:00 AI. It had been made aorretiv by prisoners.: day nt SeptYrober. meat of the property of the Mate at el on WEDNEaDAt OCTOBER MAIVIAltt:T ZANE WETCHZIL Special attention given to mail at 2 oclork nit tb. tat. of flab. at Pelt Lake City. orders. Clerkits actual memos, value. MI taxes shall tom '1, (Seal p m st the County Court HMIS.. ist Aar of Aoirest, I this Berfeten I WILLA& AL.EX. 8:445 soma es ho uniform Clerk, the IL L t" .1 elan of our Doputy in TINOIPtY Boom of said Court propSalt I,ake FREE MOVING PIIITIIIIixertnE CID,. Lilt Nimbi Jenson. Attorney for yeti thou. (Soil erty within the territorial lirolla of bated August 24, au. lath. Count,. Utah. orsottury of gaits, 10:00 , tile the tax VMS!! or. looting nota lb. Clerk of call court. with authority and Ampmblv IIIH. Temple Square, shall U. lovied and collocted for imbibe to.al thersof affixed thta net day of FrOCILHOLDERW IIEETEVI lath. pm. Aerie. day evening. September 1:40 A. IN THR 118'r Run' cot7ivr PRO. A 3.110 Roonto nog Posy Siting go purposed of only; Provided, that a do- -. Arl. telt I 'M IllArnla tha and debits from credits May be NOPelt or STOCKIIOLDER,,bLEE istubjoet. It. DPI for Arnold, I, of dortion (lab. thousand feet mos, It !Atka Coon. Amolohoovit to flootion ZANE: WirrIfIrlt. Idriatuo, kl.ttlflARFT bate 1:59 A. Three NoOa Provided or of uthortsed: further. the Photon( ronetitution of nab. 1ho ttah In tho matter that the inortherest. 0141, ty. State film and several hundred potato Pt Mar) qi Newman. Iheroasael. tating to the, Tondos of lb Auditor asel property of tits tingled Slates...of the Mg By L. Palmr. Depot), Clerk 1:05 counties. NI cities. .1. state. ft towns, school There will Imp held P.B Newman, of the Troainiree. 1,1to4aav NM !mei Harrington, NotleaThe prtitinn et, Win. !SterfOlpilefln meeting of tiq. Publl, cordially dttoiney of Ita II enootog by tho Vocialatnro of MO districts. municipal corporations for Pafliirmry and witylog oftor the 'ermines to htmaolf "4 Invtled. John P. etilm. lecturer. of the HOTEL UTAH !) 2:45 of all at the public libraries. Ws whit the build- etockhoiders Alnooetration In thet estate stat. At risk Lettere E RATIN) COMPANY. et lbe 40 Nremett. deoeord. boo lupe onotnhers Aortal to each of the two ings them. mood xclualvely the In the Hotel Utah. !,' 215 IN THE DIRTRICT COURT. PIO- of ?dory ALL THE for religious worobip or charitableeither eat for hearing n rrid.y. the 7mtt day brollIPO colocurring thero4npar. lake "mean,' 'MORGAN WILL BRING OVER hate tut town. tout for elty. n Ort tat ISIS. at I 1..oko Coun1. That it Is proyinsog to ilmiPnd pose.. and plaeos of burial not held or for I, 1913. at I o'cloolt ftrittember of th purrome of amending ankle I;30 P ty, Cod.. In the mottrt of tho o.111t0 at thO County , urt House. to this Court 11"t11011 11. A111(10 1. of al ronettionee used for private or corporate benento : of sea corporation to read as !one HIS "GRASSE FRAGONAROS" btmooret N Co !no. Iforeso Po Notice. Of aht $5.,00 to Salt, Loki City. of thaw Pieta of flak tts, thet tho 1111110 shall be exempt from taxation. Ditch... The annual The potion of Joo.t.h V: coin. ottocutor Room Lake Coon', meeting of the toraltt 5:30 follow. as t will rood teapots. rettervoirs. pip. and flumes env Utah. LIMP tertian of erne" ehell of tho potato of Ilnoteret N vain.. do- Salt 4114 efOlfft otettfor ot fowtord and need by Individuals or co- - held tor Tho Audition of It 8:00 at Raft lake Cite. Utah. mi loothise limemeire shin New York. flept, 11Pthoto altiewil ce'stL gottonos tor tho twtto.totot nt the seal thrreof ;fflar4 . this th Oat of Oubli eerowortts Webster-Wis- e anaut dal ,,of rohruary 9L. and ileonotteil t.y thot Troasienor,, motor tho toymouticohosindfoivridiurrialasaotrineett ThipenrdastiolloWorpaldor brat from. Lontion wty that J. I' 11,.ritan final aroount of ocki yorutot, mut for gepupyrto. A I) lit?. b. 00'40 t41:15 that alaa tit. thoraatter.;" tho tho of rooktoo dottrIbut,on 'Piof 11i.en4 .4 01 tho of ZISiesiliOnk StARGARIST ZAlktlt wiTctlEtt. 04 t the individual members thereof. supervision 21 East Second South !haot ronimed from him rewkleh,.. at tfall to tho poroons shall end the Stet tee Of December, ntittiol, ham 10.n oot (twat) lair and al prorl4o4 teat be amiparately taxea as long ma shall 1:45 ' lisle 10 Nowlin pteturem knoten for hooting On irldnY thoy n annisette thereafter. - Thoby the a)th &sir of be owned and used xclualvely liootioo yte- - ie Pe Palmer.- Deputy Cleric fitornotary Of Nista le S1LAM( 11011.:16 111.71:1170.. 1 PrInew p.3 Dated Solt tali illy, pre I, Ile thw INProtrf 6iree141 to embark the, tomyoaeg leer such purp000; Provided further. 11o7144 ftoptombor. Adrit HU at I Wein, k p for Tn"De ins them to NewTrarmartleind Silently 3ArtcLAN(1. Prooklet. q'tfrik.1 og Turk, where they edit at tbo County Court Howl la Lbo tits boater of lb State Ithat mortgage ansendistat SIMI boil reel - and JOHX c, cunza. . Li , Ic - , .1.. Na. , 0 . , 7 ..., !ss ': f , ' ' ' ..f , I 11'2 1:7; . coy-m- et 11, .,. I I , ,-- , I ;. ,r 0 - 4 ' , , ''' ' r ' .....".--':- 4P . ' a. I ,.'' . maim -- E 1 0, utak. Office et the Mastery of State.--eT. Charles S. Secretary Of State of the State of'navy, Visalia de hereby rectal' that the foregoing is atfulb tree and en eon, st a resolution proposing amendment to Section IT, Article VII of the Constitution of the State of Utals. rebating to nit, gauett or tas Auditor and of the Treasurer. Ia I.Omens whereof. I have hereunto 'Peal set my hand and affixed the Erect of the State of Utah. at Pelt Lake City, this 211id dat of August. M1 C. $ TINGST. Meal Secretor, of State.. A Joint Resolution PrOpOeing att of Amendment of Section I. Arttell the Constitution of the Stets of Utals,: the TfillialOIL Relating Be it resolved and enacted by the Legislature of the Slate of Utah, of all the members elected le each ot the Awe house concurring of all the Webthe two bOoses ; 4 j I . : 11. t) : t," , 1 1 ' ''' ' , 1 , , - ,.v , 1111 , .' z . 1 , - jI : 1. : P '". - 1.- '''' ','. , '' -- t 1 I ! - 'I ', - ' 4.-- -- . - t r ri. r. 1., , compestp-or-corporati- UT DM-S- t) , t ' ' - ' - to 1 , . two-thir- 4 " 1 , It ,,, , . . , , , .! - ' two-thir- , 1- 1 - - -fir . , 1 d ,," , '..,.'" - ' " Ii . ,- , . I i -- - ; -- , ., .4 ' : t , '. ', , ; z , - ,,':' '''i '' .,- p d --- '- !,,. bydro-earbo- ''' 4, . - , , , coo-tu- - , 4 r' 11, , , I ,1.i,Intleeyr ' ewe-to- re ----i;- 11 t - I 1 : . ot 4 ' ,,',. ,i - 4' - " t , - AI-neut- - ..--- ...--,- twn-third- , . 'i 1 4 .00 nesh .. , 1 p 4 o 4 ' ,4 . 'yr ' , hypo-newt- , ,' t ; k 111) sum-mo- ,, , - ,,,, 4- two-thira-ls t 110TICE ... riefltrtatemtiocillreoztlftvilmlialem.keyfretwitiglieteterneeirronfeto.tifttubhteloavatseashaf. asto,--Ce- I 0 iMmIMMEND 4 ri. - l';' i 8-- t carom-attest- 1 :usty: t: laassf:rtt 4., IIA nteh .0110 ette leseit ,ki ; , KINSONS it tal 1 toot-to- 0 twit-Bo- 71! I Al it ogal Shoes na PI et" two-thir- LATEST p A $3.85 to p.k all M,,M.00MON Co. - 414 t px px I slautarp , , s |